GLYAT Antibody

Name GLYAT Antibody
Supplier Novus Biologicals
Catalog NBP1-54714
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC
Species Reactivities Human
Antigen Synthetic peptides corresponding to GLYAT(glycine-N-acyltransferase) The peptide sequence was selected from the N terminal of GLYAT. Peptide sequence HYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GLYAT
Conjugate Unconjugated
Supplier Page Shop

Product images