ALAS2 Antibody

Name ALAS2 Antibody
Supplier Novus Biologicals
Catalog NBP1-54727
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ALAS2(aminolevulinate, delta-, synthase 2) The peptide sequence was selected from the C terminal of ALAS2. Peptide sequence PTVPRGEELLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVAACN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ALAS2
Conjugate Unconjugated
Supplier Page Shop

Product images