GNL1 Antibody

Name	GNL1 Antibody
Supplier	Novus Biologicals
Catalog	NBP2-14062
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB IHC IHC-P
Species Reactivities	Human, Rat
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids: LHFERDSREEVERRKRAAREQVLQPVSAELLELDIREVYQPGSVLDFPRR PPWSYEMSKEQLMSQEERSFQDYLGKIHGAY
Purity/Format	Immunogen affinity purified
Blocking Peptide	GNL1 Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	GNL1
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: GNL1 Antibody [NBP2-14062] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: GNL1 Antibody [NBP2-14062] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Western Blot: GNL1 Antibody [NBP2-14062] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: Human cell line RT-4; Lane 3: Human cell line U-251MG; Lane 4: Human Plasma; Lane 5: Human liver tissue; Lane 6: Human tonsil tissue