GRHL2 Antibody
| Name | GRHL2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88552 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRSTPDSTYSESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYTLEATKSLRQK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GRHL2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GRHL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GRHL2 Antibody [NBP1-88552] - Analysis in control (vector only transfected HEK293T lysate) and gRHL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3229_GRHL2-Antibody-Western-Blot-NBP1-88552-img0008.jpg)
Western Blot: GRHL2 Antibody [NBP1-88552] - Analysis in control (vector only transfected HEK293T lysate) and gRHL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
![Immunocytochemistry/Immunofluorescence: GRHL2 Antibody [NBP1-88552] - Staining of human cell line RT4 shows positivity in plasma membrane and nucleus but excluded from the nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3230_GRHL2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88552-img0010.jpg)
Immunocytochemistry/Immunofluorescence: GRHL2 Antibody [NBP1-88552] - Staining of human cell line RT4 shows positivity in plasma membrane and nucleus but excluded from the nucleoli.
![Immunohistochemistry-Paraffin: GRHL2 Antibody [NBP1-88552] - Immunohistochemical staining of human liver shows no positivity as expected.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3231_GRHL2-Antibody-Immunohistochemistry-Paraffin-NBP1-88552-img0007.jpg)
Immunohistochemistry-Paraffin: GRHL2 Antibody [NBP1-88552] - Immunohistochemical staining of human liver shows no positivity as expected.
![Immunohistochemistry-Paraffin: GRHL2 Antibody [NBP1-88552] - Immunohistochemical staining of human prostate shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3232_GRHL2-Antibody-Immunohistochemistry-Paraffin-NBP1-88552-img0004.jpg)
Immunohistochemistry-Paraffin: GRHL2 Antibody [NBP1-88552] - Immunohistochemical staining of human prostate shows strong nuclear positivity in glandular cells.
![Immunohistochemistry-Paraffin: GRHL2 Antibody [NBP1-88552] - Immunohistochemical staining of human skin shows strong nuclear positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3233_GRHL2-Antibody-Immunohistochemistry-Paraffin-NBP1-88552-img0005.jpg)
Immunohistochemistry-Paraffin: GRHL2 Antibody [NBP1-88552] - Immunohistochemical staining of human skin shows strong nuclear positivity in squamous epithelial cells.
![Immunohistochemistry-Paraffin: GRHL2 Antibody [NBP1-88552] - Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3234_GRHL2-Antibody-Immunohistochemistry-Paraffin-NBP1-88552-img0006.jpg)
Immunohistochemistry-Paraffin: GRHL2 Antibody [NBP1-88552] - Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells.