LIAS Antibody

Name	LIAS Antibody
Supplier	Novus Biologicals
Catalog	NBP1-82845
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB ICC/IF IHC IHC-P
Species Reactivities	Human, Rat
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:SKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTRRHLK
Purity/Format	Immunogen affinity purified
Blocking Peptide	LIAS Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	LIAS
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: LIAS Antibody [NBP1-82845] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: LIAS Antibody [NBP1-82845] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.

Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human cerebral cortex shows cytoplasmic positivity in neurons.

Immunocytochemistry/Immunofluorescence: LIAS Antibody [NBP1-82845] - Staining of mouse cerebellum shows positivity in Purkinje cell bodies and dendrites.

Immunocytochemistry/Immunofluorescence: LIAS Antibody [NBP1-82845] - Staining of mouse lateral ventricle shows nuclear labeling in a subset of cells in the choroid plexus and lateral ventricle wall.

Immunocytochemistry/Immunofluorescence: LIAS Antibody [NBP1-82845] - Staining of mouse subfornical organ shows nuclear positivity in a subset of cells.

Immunohistochemistry: LIAS Antibody [NBP1-82845] - Staining of human hippocampus shows cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human cerebellum shows cytoplasmic immunoreactivity in Purkinje cells.