SRPRB Antibody
| Name | SRPRB Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59710 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SRPRB(signal recognition particle receptor, B subunit) The peptide sequence was selected from the middle region of SRPRB. Peptide sequence QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SRPRB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SRPRB Antibody [NBP1-59710] - Jurkat, Antibody Dilution: 1.0 ug/ml SRPRB is supported by BioGPS gene expression data to be expressed in Jurkat.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19921_SRPRB-Antibody-Western-Blot-NBP1-59710-img0005.jpg)
Western Blot: SRPRB Antibody [NBP1-59710] - Jurkat, Antibody Dilution: 1.0 ug/ml SRPRB is supported by BioGPS gene expression data to be expressed in Jurkat.
![Immunohistochemistry: SRPRB Antibody [NBP1-59710] - Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19922_SRPRB-Antibody-Immunohistochemistry-NBP1-59710-img0006.jpg)
Immunohistochemistry: SRPRB Antibody [NBP1-59710] - Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
![Western Blot: SRPRB Antibody [NBP1-59710] - Hela cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19923_SRPRB-Antibody-Western-Blot-NBP1-59710-img0002.jpg)
Western Blot: SRPRB Antibody [NBP1-59710] - Hela cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: SRPRB Antibody [NBP1-59710] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml SRPRB is supported by BioGPS gene expression data to be expressed in 721_B.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19924_SRPRB-Antibody-Western-Blot-NBP1-59710-img0004.jpg)
Western Blot: SRPRB Antibody [NBP1-59710] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml SRPRB is supported by BioGPS gene expression data to be expressed in 721_B.