RABGGTA Antibody
| Name | RABGGTA Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55183 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RABGGTA(Rab geranylgeranyltransferase, alpha subunit) The peptide sequence was selected from the N terminal of RABGGTA (NP_878256). Peptide sequence ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RABGGTA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RABGGTA Antibody [NBP1-55183] - Antibody Titration: 0.2-1 ug/ml Positive control: Jurkat cell lysate RABGGTA is supported by BioGPS gene expression data to be expressed in Jurkat.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14720_RABGGTA-Antibody-Western-Blot-NBP1-55183-img0003.jpg)
Western Blot: RABGGTA Antibody [NBP1-55183] - Antibody Titration: 0.2-1 ug/ml Positive control: Jurkat cell lysate RABGGTA is supported by BioGPS gene expression data to be expressed in Jurkat.
![Western Blot: RABGGTA Antibody [NBP1-55183] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14721_RABGGTA-Antibody-Western-Blot-NBP1-55183-img0002.jpg)
Western Blot: RABGGTA Antibody [NBP1-55183] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: RABGGTA Antibody [NBP1-55183] - Hela, Antibody Dilution: 1.0 ug/ml RABGGTA is supported by BioGPS gene expression data to be expressed in HeLa.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14722_RABGGTA%2520Antibody-Western%2520Blot-NBP1-55183-img0004.jpg)
Western Blot: RABGGTA Antibody [NBP1-55183] - Hela, Antibody Dilution: 1.0 ug/ml RABGGTA is supported by BioGPS gene expression data to be expressed in HeLa.