GABARAPL1 Antibody

Name	GABARAPL1 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-55202
Prices	$329.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB IHC IHC-P
Species Reactivities	Human
Antigen	Synthetic peptides corresponding to GABARAPL1(GABA(A) receptor-associated protein like 1) The peptide sequence was selected from the N terminal of GABARAPL1 (NP_113600). Peptide sequence MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL.
Purity/Format	Immunogen affinity purified
Description	Rabbit Polyclonal
Gene	GABARAPL1
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: GABARAPL1 Antibody [NBP1-55202] - Hela Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.

Immunohistochemistry-Paraffin: GABARAPL1 Antibody [NBP1-55202] - Human Brain lysate tissue at an Antibody concentration of 5.0 ug/ml using anti-GABARAPL1 Antibody (ARP55398_P050).

Western Blot: GABARAPL1 Antibody [NBP1-55202] - Transfected 293T tissue lysate at a concentration of 1ug/ml.

Immunohistochemistry-Paraffin: GABARAPL1 Antibody [NBP1-55202] - Human Brain Tissue, antibody concentration 5ug/ml. Cells with positive label: Neural cells (indicated with arrows) 400X mgnification.

Immunohistochemistry-Paraffin: GABARAPL1 Antibody [NBP1-55202] - Human spleen.