beta Adducin Antibody
| Name | beta Adducin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53079 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ADD2(adducin 2 (beta)) The peptide sequence was selected from the middle region of ADD2. Peptide sequence VVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ADD2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: beta Adducin Antibody [NBP1-53079] - Transfected 293T tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14417_beta-Adducin-Antibody-Western-Blot-NBP1-53079-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: beta Adducin Antibody [NBP1-53079] - HEI-OC1 DAP1 Anti-beta-ADD](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14418_beta-Adducin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-53079-img0002.jpg)