POLR3A Antibody

Name POLR3A Antibody
Supplier Novus Biologicals
Catalog NBP1-53051
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to POLR3A(polymerase (RNA) III (DNA directed) polypeptide A, 155kDa) The peptide sequence was selected from the middle region of POLR3A (NP_008986). Peptide sequence AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene POLR3A
Conjugate Unconjugated
Supplier Page Shop

Product images