CHAC2 Antibody

Name CHAC2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56821
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CHAC2(ChaC, cation transport regulator homolog 2 (E. coli)) The peptide sequence was selected from the N terminal of CHAC2. Peptide sequence MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CHAC2
Conjugate Unconjugated
Supplier Page Shop

Product images