CHCHD3 Antibody

Name CHCHD3 Antibody
Supplier Novus Biologicals
Catalog NBP1-56871
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CHCHD3(coiled-coil-helix-coiled-coil-helix domain containing 3) The peptide sequence was selected from the middle region of CHCHD3. Peptide sequence LRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CHCHD3
Conjugate Unconjugated
Supplier Page Shop

Product images