SFRS5 Antibody
| Name | SFRS5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92381 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SFRS5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SRSF5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SFRS5 Antibody [NBP1-92381] - Analysis in human cell line HeLa.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22273_SFRS5-Antibody-Western-Blot-NBP1-92381-img0007.jpg)
Western Blot: SFRS5 Antibody [NBP1-92381] - Analysis in human cell line HeLa.
![Immunocytochemistry/Immunofluorescence: SFRS5 Antibody [NBP1-92381] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22274_SFRS5%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92381-img0008.jpg)
Immunocytochemistry/Immunofluorescence: SFRS5 Antibody [NBP1-92381] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
![Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22275_SFRS5-Antibody-Immunohistochemistry-Paraffin-NBP1-92381-img0002.jpg)
Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.
![Western Blot: SFRS5 Antibody [NBP1-92381] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22276_SFRS5-Antibody-Western-Blot-NBP1-92381-img0006.jpg)
Western Blot: SFRS5 Antibody [NBP1-92381] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).