Glycogen synthase 2 Antibody
| Name | Glycogen synthase 2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91191 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Glycogen synthase 2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GYS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Glycogen synthase 2 Antibody [NBP1-91191] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/15416_Glycogen%2520synthase%25202%2520Antibody-Western%2520Blot-NBP1-91191-img0007.jpg)
Western Blot: Glycogen synthase 2 Antibody [NBP1-91191] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
![Immunocytochemistry/Immunofluorescence: Glycogen synthase 2 Antibody [NBP1-91191] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/15417_Glycogen-synthase-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91191-img0004.jpg)
Immunocytochemistry/Immunofluorescence: Glycogen synthase 2 Antibody [NBP1-91191] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm.
![Immunohistochemistry-Paraffin: Glycogen synthase 2 Antibody [NBP1-91191] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/15418_Glycogen-synthase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-91191-img0002.jpg)
Immunohistochemistry-Paraffin: Glycogen synthase 2 Antibody [NBP1-91191] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
![Western Blot: Glycogen synthase 2 Antibody [NBP1-91191] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/15419_Glycogen-synthase-2-Antibody-Western-Blot-NBP1-91191-img0006.jpg)
Western Blot: Glycogen synthase 2 Antibody [NBP1-91191] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate