Kaptin Antibody

Name	Kaptin Antibody
Supplier	Novus Biologicals
Catalog	NBP1-92035
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB ICC/IF IHC IHC-P
Species Reactivities	Human
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:FLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVL
Purity/Format	Immunogen affinity purified
Blocking Peptide	Kaptin Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	KPTN
Supplier Page	Shop

Product images

Immunocytochemistry/Immunofluorescence: Kaptin Antibody [NBP1-92035] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, plasma membrane & cytoplasm.

Immunohistochemistry-Paraffin: Kaptin Antibody [NBP1-92035] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Western Blot: Kaptin Antibody [NBP1-92035] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)<br/>Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Western Blot: Kaptin Antibody [NBP1-92035] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Western Blot: Kaptin Antibody [NBP1-92035] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4

Western Blot: Kaptin Antibody [NBP1-92035] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4