OTUD3 Antibody

Name	OTUD3 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-90485
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB ICC/IF IHC IHC-P
Species Reactivities	Human
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:KGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNAEENLEPSGRVLKQCGP
Purity/Format	Immunogen affinity purified
Blocking Peptide	OTUD3 Protein
Description	Rabbit Polyclonal
Gene	OTUD3
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: OTUD3 Antibody [NBP1-90485] - Analysis in human cell line RH-30.

Immunocytochemistry/Immunofluorescence: OTUD3 Antibody [NBP1-90485] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & intermediate filaments.

Immunohistochemistry-Paraffin: OTUD3 Antibody [NBP1-90485] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Immunohistochemistry-Paraffin: OTUD3 Antibody [NBP1-90485] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells.