PGRMC2 Antibody
| Name | PGRMC2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13753 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: RWRAVMAAGDGDVKLGTLGSGSESSNDGGSESPCDA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PGRMC2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PGRMC2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PGRMC2 Antibody [NBP2-13753] - Analysis in human cell line A-431.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5787_PGRMC2-Antibody-Western-Blot-NBP2-13753-img0005.jpg)
Western Blot: PGRMC2 Antibody [NBP2-13753] - Analysis in human cell line A-431.
![Immunocytochemistry/Immunofluorescence: PGRMC2 Antibody [NBP2-13753] - Staining of human cell line HeLa shows localization to nuclear bodies, nuclear membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5788_PGRMC2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13753-img0006.jpg)
Immunocytochemistry/Immunofluorescence: PGRMC2 Antibody [NBP2-13753] - Staining of human cell line HeLa shows localization to nuclear bodies, nuclear membrane & cytosol.
![Immunohistochemistry-Paraffin: PGRMC2 Antibody [NBP2-13753] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5789_PGRMC2-Antibody-Immunohistochemistry-Paraffin-NBP2-13753-img0001.jpg)
Immunohistochemistry-Paraffin: PGRMC2 Antibody [NBP2-13753] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
![Immunocytochemistry/Immunofluorescence: PGRMC2 Antibody [NBP2-13753] - Staining of human cell line HeLa shows positivity in nuclear membrane and cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5790_PGRMC2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13753-img0003.jpg)
Immunocytochemistry/Immunofluorescence: PGRMC2 Antibody [NBP2-13753] - Staining of human cell line HeLa shows positivity in nuclear membrane and cytoplasm.