FAM111B Antibody
| Name | FAM111B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86645 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SMKTEENKSFSAMEDDQRTRPEVSKDTVMKQTHADTPVDHCLSGIRKCSSTFKLKSEVNKHETALEMQNPNLNNKECCFTFTLNGNS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM111B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FAM111B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FAM111B Antibody [NBP1-86645] - Analysis in human cell line U-2197.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22107_FAM111B-Antibody-Western-Blot-NBP1-86645-img0008.jpg)
Western Blot: FAM111B Antibody [NBP1-86645] - Analysis in human cell line U-2197.
![Immunocytochemistry/Immunofluorescence: FAM111B Antibody [NBP1-86645] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22108_FAM111B%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86645-img0010.jpg)
Immunocytochemistry/Immunofluorescence: FAM111B Antibody [NBP1-86645] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.
![Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human tonsil shows moderate nuclear and cytoplasmic positivity in germinal and non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22109_FAM111B-Antibody-Immunohistochemistry-Paraffin-NBP1-86645-img0009.jpg)
Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human tonsil shows moderate nuclear and cytoplasmic positivity in germinal and non-germinal center cells.
![Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human tonsil shows moderate nuclear positivity in non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22110_FAM111B-Antibody-Immunohistochemistry-Paraffin-NBP1-86645-img0007.jpg)
Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human tonsil shows moderate nuclear positivity in non-germinal center cells.