CENPV Antibody
| Name | CENPV Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84545 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NLDLGEQRERWETFQKRQKLTSEGAAKLLLDTFEYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKKQN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CENPV Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CENPV |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CENPV Antibody [NBP1-84545] - Analysis in human cell line HEK 293.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13498_CENPV-Antibody-Western-Blot-NBP1-84545-img0007.jpg)
Western Blot: CENPV Antibody [NBP1-84545] - Analysis in human cell line HEK 293.
![Immunocytochemistry/Immunofluorescence: CENPV Antibody [NBP1-84545] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13499_CENPV-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84545-img0010.jpg)
Immunocytochemistry/Immunofluorescence: CENPV Antibody [NBP1-84545] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
![Immunohistochemistry-Paraffin: CENPV Antibody [NBP1-84545] - Staining of human testis shows strong positivity in cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13500_CENPV-Antibody-Immunohistochemistry-Paraffin-NBP1-84545-img0011.jpg)
Immunohistochemistry-Paraffin: CENPV Antibody [NBP1-84545] - Staining of human testis shows strong positivity in cells in seminiferous ducts.
![Immunocytochemistry/Immunofluorescence: CENPV Antibody [NBP1-84545] - Staining of human cell line A-431 shows positivity in cytoplasm and nucleus but excluded from the nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13501_CENPV-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84545-img0009.jpg)
Immunocytochemistry/Immunofluorescence: CENPV Antibody [NBP1-84545] - Staining of human cell line A-431 shows positivity in cytoplasm and nucleus but excluded from the nucleoli.
![Immunohistochemistry-Paraffin: CENPV Antibody [NBP1-84545] - Staining of human liver shows strong nuclear positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13502_CENPV-Antibody-Immunohistochemistry-Paraffin-NBP1-84545-img0002.jpg)
Immunohistochemistry-Paraffin: CENPV Antibody [NBP1-84545] - Staining of human liver shows strong nuclear positivity in hepatocytes.