NT5C Antibody

Name	NT5C Antibody
Supplier	Novus Biologicals
Catalog	NBP1-84563
Prices	$129.00, $419.00
Sizes	25 µl, 100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB Simple Western ICC/IF IHC IHC-P
Species Reactivities	Human
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:VLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIP
Purity/Format	Immunogen affinity purified
Blocking Peptide	NT5C Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	NT5C
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Immunocytochemistry/Immunofluorescence: NT5C Antibody [NBP1-84563] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: NT5C Antibody [NBP1-84563] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Simple Western: NT5C Antibody [NBP1-84563] - Simple Western lane view shows a specific band for NT5C in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: NT5C Antibody [NBP1-84563] - Simple Western lane view shows a specific band for NT5C in 0.2 mg/ml of U-2OS lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: NT5C Antibody [NBP1-84563] - Electropherogram image(s) of corresponding Simple Western lane view. NT5C antibody was used at 1:20 dilution on U-2OS lysates(s).