HspB11 Antibody

Name	HspB11 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-88332
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB ICC/IF IHC IHC-P
Species Reactivities	Human
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:IDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQT
Purity/Format	Immunogen affinity purified
Blocking Peptide	HspB11 Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	HSPB11
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: HspB11 Antibody [NBP1-88332] - Analysis in human cell line RT-4, human cell line U-251 MG and human plasma.

Immunocytochemistry/Immunofluorescence: HspB11 Antibody [NBP1-88332] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: HspB11 Antibody [NBP1-88332] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.

Western Blot: HspB11 Antibody [NBP1-88332] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: HspB11 Antibody [NBP1-88332] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.