NDUFC2 Antibody

Name	NDUFC2 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-88934
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB Simple Western ICC/IF IHC IHC-P
Species Reactivities	Human
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRP
Purity/Format	Immunogen affinity purified
Blocking Peptide	NDUFC2 Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	NDUFC2
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: NDUFC2 Antibody [NBP1-88934] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: CACO-2

Immunocytochemistry/Immunofluorescence: NDUFC2 Antibody [NBP1-88934] - Staining of human cell line U-2 OS shows positivity in mitochondria. Antibody staining is shown in green.

Immunohistochemistry: NDUFC2 Antibody [NBP1-88934] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Simple Western: NDUFC2 Antibody [NBP1-88934] - Simple Western lane view shows a specific band for NDUFC2 in 0.2 mg/ml of HT-29 (left) and HCT 116 (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.

Simple Western: NDUFC2 Antibody [NBP1-88934] - Electropherogram image of the corresponding Simple Western lane view. NDUFC2 antibody was used at 1:10 dilution on HT-29 and HCT 116 lysate(s) respectively.