Testin Antibody
| Name | Testin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87987 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Testin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TES |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Testin Antibody [NBP1-87987] - Analysis in human cell line EFO-21.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10320_Testin-Antibody-Western-Blot-NBP1-87987-img0009.jpg)
Western Blot: Testin Antibody [NBP1-87987] - Analysis in human cell line EFO-21.
![Immunocytochemistry/Immunofluorescence: Testin Antibody [NBP1-87987] - Immunofluorescent staining of human cell line SiHa shows localization to cytosol & focal adhesion sites.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10321_Testin%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87987-img0012.jpg)
Immunocytochemistry/Immunofluorescence: Testin Antibody [NBP1-87987] - Immunofluorescent staining of human cell line SiHa shows localization to cytosol & focal adhesion sites.
![Immunohistochemistry-Paraffin: Testin Antibody [NBP1-87987] - Staining of human tonsil shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10322_Testin-Antibody-Immunohistochemistry-Paraffin-NBP1-87987-img0001.jpg)
Immunohistochemistry-Paraffin: Testin Antibody [NBP1-87987] - Staining of human tonsil shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.
![Simple Western: Testin Antibody [NBP1-87987] - Simple Western lane view shows a specific band for TES in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10323_Testin-Antibody-Simple-Western-NBP1-87987-img0007.jpg)
Simple Western: Testin Antibody [NBP1-87987] - Simple Western lane view shows a specific band for TES in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: Testin Antibody [NBP1-87987] - Electropherogram image(s) of corresponding Simple Western lane view. Testin antibody was used at 1:20 dilution on RT-4 lysate(s).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10324_Testin-Antibody-Simple-Western-NBP1-87987-img0008.jpg)
Simple Western: Testin Antibody [NBP1-87987] - Electropherogram image(s) of corresponding Simple Western lane view. Testin antibody was used at 1:20 dilution on RT-4 lysate(s).