PPP4R4 Antibody

Name	PPP4R4 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-81393
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB ICC/IF IHC IHC-P
Species Reactivities	Human
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:SLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAVYLLSAGQDVQGTSVIANLPFLMRQNPTETLRRVLPKVR
Purity/Format	Immunogen affinity purified
Blocking Peptide	PPP4R4 Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	PPP4R4
Supplier Page	Shop

Product images

Western Blot: PPP4R4 Antibody [NBP1-81393] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue

Western Blot: PPP4R4 Antibody [NBP1-81393] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue

Immunocytochemistry/Immunofluorescence: PPP4R4 Antibody [NBP1-81393] - Staining of human cell line U-2 OS shows positivity in cytoplasm.

Immunohistochemistry-Paraffin: PPP4R4 Antibody [NBP1-81393] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.