GABA-A R delta Antibody

Name	GABA-A R delta Antibody
Supplier	Novus Biologicals
Catalog	NBP2-33421
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB IHC IHC-P
Species Reactivities	Human
Antigen	This antibody was developed against a recombinant protein corresponding to amino acids: KVKVSRPRAEMDVRNAIVLFSLSAAGVTQELAISRRQRRVPGNLMGSYRSVGVETGETKKEGAARSGGQGGIRARL
Purity/Format	Immunogen affinity purified
Blocking Peptide	GABA-A R delta Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	GABRD
Supplier Page	Shop

Product images

Western Blot: GABA-A R delta Antibody [NBP2-33421] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue

Western Blot: GABA-A R delta Antibody [NBP2-33421] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: GABA-A R delta Antibody [NBP2-33421] - liver cancer

Immunohistochemistry-Paraffin: GABA-A R delta Antibody [NBP2-33421] - Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: GABA-A R delta Antibody [NBP2-33421] - liver