FYTTD1 Antibody
| Name | FYTTD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33715 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: IIKLNRKEGKKQNFPRLNRRLLQQSGAQQFRMRVRWGIQQNSGFGKTSLNHRGRVMPGKRRPNGVITGLA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FYTTD1 Protein |
| Description | Rabbit Polyclonal |
| Gene | FYTTD1 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FYTTD1 Antibody [NBP2-33715] - Immunofluorescent staining of human cell line MCF-7 shows positivity in nucleus but excluded from the nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16920_FYTTD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33715-img0001.jpg)
Immunocytochemistry/Immunofluorescence: FYTTD1 Antibody [NBP2-33715] - Immunofluorescent staining of human cell line MCF-7 shows positivity in nucleus but excluded from the nucleoli.
![Immunohistochemistry-Paraffin: FYTTD1 Antibody [NBP2-33715] - rectum](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16921_FYTTD1-Antibody-Immunohistochemistry-Paraffin-NBP2-33715-img0003.jpg)
Immunohistochemistry-Paraffin: FYTTD1 Antibody [NBP2-33715] - rectum
![Immunohistochemistry-Paraffin: FYTTD1 Antibody [NBP2-33715] - Immunohistochemical staining of human testis shows weak nuclear positivity in a subset of cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16922_FYTTD1-Antibody-Immunohistochemistry-Paraffin-NBP2-33715-img0002.jpg)
Immunohistochemistry-Paraffin: FYTTD1 Antibody [NBP2-33715] - Immunohistochemical staining of human testis shows weak nuclear positivity in a subset of cells in seminiferus ducts.
![Immunohistochemistry-Paraffin: FYTTD1 Antibody [NBP2-33715] - urothelial cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16923_FYTTD1%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33715-img0004.jpg)
Immunohistochemistry-Paraffin: FYTTD1 Antibody [NBP2-33715] - urothelial cancer