MIA3 Antibody

Name	MIA3 Antibody
Supplier	Novus Biologicals
Catalog	NBP2-33770
Prices	$129.00, $419.00
Sizes	25 µl, 100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB ICC/IF IHC IHC-P
Species Reactivities	Human
Antigen	This antibody was developed against a recombinant protein corresponding to amino acids: DSKQGKPQSATDYSDPDNVDDGLFIVDIPKTNNDKEVNAEHHIKGKGRGVQESKRGLVQDETELEDENQEGMTVHSSVHSNNLNSMPA
Purity/Format	Immunogen affinity purified
Blocking Peptide	MIA3 Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	MIA3
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: MIA3 Antibody [NBP2-33770] - Analysis in human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: MIA3 Antibody [NBP2-33770] - Immunofluorescent staining of human cell line A549 shows localization to vesicles.

Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-33770] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-33770] - Staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.

Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-33770] - Staining of liver.

Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-33770] - Staining of colorectal cancer.