HIVEP2 Antibody
| Name | HIVEP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33771 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: IQPTSYMTSKHLPEQPHLFPHQETIPFSPIQNALFQFQYPTVCMVHLPAQQPPWWQAHFPHPFAQHPQKSYGKPSFQTEIHSSYP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HIVEP2 Protein |
| Description | Rabbit Polyclonal |
| Gene | HIVEP2 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: HIVEP2 Antibody [NBP2-33771] - Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16868_HIVEP2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33771-img0001.jpg)
Immunocytochemistry/Immunofluorescence: HIVEP2 Antibody [NBP2-33771] - Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
![Immunohistochemistry-Paraffin: HIVEP2 Antibody [NBP2-33771] - cerebellum](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16869_HIVEP2-Antibody-Immunohistochemistry-Paraffin-NBP2-33771-img0003.jpg)
Immunohistochemistry-Paraffin: HIVEP2 Antibody [NBP2-33771] - cerebellum
![Immunohistochemistry-Paraffin: HIVEP2 Antibody [NBP2-33771] - Immunohistochemical staining of human cerebellum shows moderate cytoplasmic and nuclear positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16870_HIVEP2-Antibody-Immunohistochemistry-Paraffin-NBP2-33771-img0002.jpg)
Immunohistochemistry-Paraffin: HIVEP2 Antibody [NBP2-33771] - Immunohistochemical staining of human cerebellum shows moderate cytoplasmic and nuclear positivity in Purkinje cells.
![Immunohistochemistry-Paraffin: HIVEP2 Antibody [NBP2-33771] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16871_HIVEP2%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33771-img0004.jpg)
Immunohistochemistry-Paraffin: HIVEP2 Antibody [NBP2-33771] - liver cancer