DCST1 Antibody
| Name | DCST1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59775 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to DCST1(DC-STAMP domain containing 1) The peptide sequence was selected from the C terminal of DCST1. Peptide sequence SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DCST1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: DCST1 Antibody [NBP1-59775] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24161_DCST1%2520Antibody-Western%2520Blot-NBP1-59775-img0001.jpg)
![Immunohistochemistry-Paraffin: DCST1 Antibody [NBP1-59775] - Human Heart Tissue, antibody concentration 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24162_DCST1%2520Antibody-Immunohistochemistry-Paraffin-NBP1-59775-img0002.jpg)