NKD1 Antibody
| Name | NKD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55270 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Guinea Pig |
| Antigen | Synthetic peptide directed towards the N terminal of human NKD1 (NP_149110). Peptide sequence: ELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPG. |
| Purity/Format | Affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NKD1 |
| Supplier Page | Shop |
![Western Blot: NKD1 Antibody [NBP1-55270] - HepG2 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/10148_NKD1%2520Antibody-Western%2520Blot-NBP1-55270-img0001.jpg)
![Immunohistochemistry-Paraffin: NKD1 Antibody [NBP1-55270] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/10149_NKD1%2520Antibody-Immunohistochemistry-Paraffin-NBP1-55270-img0003.jpg)