RAB14 Antibody
| Name | RAB14 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79962 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Monkey |
| Antigen | Synthetic peptide directed towards the C terminal of human RAB14The immunogen for this antibody is RAB14. Peptide sequence FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RAB14 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RAB14 Antibody [NBP1-79962] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4030_RAB14-Antibody-Western-Blot-NBP1-79962-img0005.jpg)
Western Blot: RAB14 Antibody [NBP1-79962] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
![Western Blot: RAB14 Antibody [NBP1-79962] - 1. Human Cervical Cancer Cell Lysate (15ug) 2. Monkey Fibroblast Cell Lysate (15ug) 3. Human Cervical Cancer Cell transfected with mouse Rab14-GFP (15ug) at 1:1000.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4031_RAB14-Antibody-Western-Blot-NBP1-79962-img0002.jpg)
Western Blot: RAB14 Antibody [NBP1-79962] - 1. Human Cervical Cancer Cell Lysate (15ug) 2. Monkey Fibroblast Cell Lysate (15ug) 3. Human Cervical Cancer Cell transfected with mouse Rab14-GFP (15ug) at 1:1000.
![Western Blot: RAB14 Antibody [NBP1-79962] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4032_RAB14-Antibody-Western-Blot-NBP1-79962-img0003.jpg)
Western Blot: RAB14 Antibody [NBP1-79962] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
![Western Blot: RAB14 Antibody [NBP1-79962] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.0ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4033_RAB14-Antibody-Western-Blot-NBP1-79962-img0004.jpg)
Western Blot: RAB14 Antibody [NBP1-79962] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.0ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%