Name | PLEKHH2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-70677 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PLEKHH2(pleckstrin homology domain containing, family H (with MyTH4 domain) member 2) The peptide sequence was selected from the C terminal of PLEKHH2. Peptide sequence WQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTE |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | PLEKHH2 |
Conjugate | Unconjugated |
Supplier Page | Shop |