GRHL2 Antibody
| Name | GRHL2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80369 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human GRHL2. Peptide sequence VEKIAKLYKKSKKGILVNMDDNIIEHYSNEDTFILNMESMVEGFKVTLME. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GRHL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: GRHL2 Antibody [NBP1-80369] - 721_B Cell Lysate 1ug/ml Gel Concentration 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24647_GRHL2-Antibody-Western-Blot-NBP1-80369-img0001.jpg)
![Immunohistochemistry-Paraffin: GRHL2 Antibody [NBP1-80369] - Human Brain lysate, antibody concentration 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24648_GRHL2-Antibody-Immunohistochemistry-Paraffin-NBP1-80369-img0002.jpg)