ACADVL Antibody

Name	ACADVL Antibody
Supplier	Novus Biologicals
Catalog	NBP1-54378
Prices	$329.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB ICC/IF
Species Reactivities	Human
Antigen	Synthetic peptides corresponding to ACADVL(acyl-Coenzyme A dehydrogenase, very long chain) The peptide sequence was selected from the N terminal of ACADVL (NP_001029031). Peptide sequence RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV.
Purity/Format	Immunogen affinity purified
Description	Rabbit Polyclonal
Gene	ACADVL
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: ACADVL Antibody [NBP1-54378] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Immunocytochemistry/Immunofluorescence: ACADVL Antibody [NBP1-54378] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies of pinealocytes; Primary Antibody Concentration: 1:100

Western Blot: ACADVL Antibody [NBP1-54378] - Lanes: 1 : Normal controls Normal enzyme expression 2: Normal controls Normal enzyme expression 3: Positive mutants Defective enzyme expression 4: Positive mutants Defective enzyme expression 5: Positive mutants Defective enzyme expression Primary Antibody Dilution: 1 : 2000 Secondary Antibody: Secondary Antibody Dilution: 1 : 1000 Gene name: ACADVL Submitted by: David Lombert, Medical College of Wisconsin.

Western Blot: ACADVL Antibody [NBP1-54378] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml ACADVL is supported by BioGPS gene expression data to be expressed in HeLa

Western Blot: ACADVL Antibody [NBP1-54378] - Sample Type: Human Fetal Muscle Antibody Dilution: 1.0 ug/ml

Western Blot: ACADVL Antibody [NBP1-54378] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: HepG2 cell lysate ACADVL is supported by BioGPS gene expression data to be expressed in HepG2