Kynureninase Antibody

Name Kynureninase Antibody
Supplier Novus Biologicals
Catalog NBP1-57569
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KYNU(kynureninase (L-kynurenine hydrolase)) The peptide sequence was selected from the N terminal of KYNU. Peptide sequence MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPK.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene KYNU
Conjugate Unconjugated
Supplier Page Shop

Product images