DCP2 Antibody

Name DCP2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57441
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DCP2(DCP2 decapping enzyme homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of DCP2. Peptide sequence KQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DCP2
Conjugate Unconjugated
Supplier Page Shop

Product images