Alanyl tRNA synthetase Antibody

Name	Alanyl tRNA synthetase Antibody
Supplier	Novus Biologicals
Catalog	NBP1-57136
Prices	$139.00, $329.00
Sizes	20 µl, 100 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB ICC/IF IHC
Species Reactivities	Human
Antigen	Synthetic peptides corresponding to AARS(alanyl-tRNA synthetase) The peptide sequence was selected from the C terminal of AARS. Peptide sequence VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT.
Purity/Format	Immunogen affinity purified
Description	Rabbit Polyclonal
Gene	AARS
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: Alanyl tRNA synthetase Antibody [NBP1-57136] - Sample Type: Jurkat Antibody Dilution: 1.0 ug/ml AARS is supported by BioGPS gene expression data to be expressed in Jurkat

Immunohistochemistry: Alanyl tRNA synthetase Antibody [NBP1-57136] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic in cell processes of pinealocytes Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Western Blot: Alanyl tRNA synthetase Antibody [NBP1-57136] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: Jurkat cell lysate AARS is supported by BioGPS gene expression data to be expressed in Jurkat

Immunohistochemistry: Alanyl tRNA synthetase Antibody [NBP1-57136] - Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X

Immunohistochemistry: Alanyl tRNA synthetase Antibody [NBP1-57136] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec Protocol located in Reviews and Data.