PHF6 Antibody
| Name | PHF6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88646 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYHYHCALHDK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PHF6 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PHF6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PHF6 Antibody [NBP1-88646] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16850_PHF6-Antibody-Western-Blot-NBP1-88646-img0007.jpg)
Western Blot: PHF6 Antibody [NBP1-88646] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
![Immunocytochemistry/Immunofluorescence: PHF6 Antibody [NBP1-88646] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16851_PHF6%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88646-img0009.jpg)
Immunocytochemistry/Immunofluorescence: PHF6 Antibody [NBP1-88646] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli.
![Immunohistochemistry-Paraffin: PHF6 Antibody [NBP1-88646] - Staining of human ovary shows strong nuclear positivity in follicle and ovarian stroma cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16852_PHF6-Antibody-Immunohistochemistry-Paraffin-NBP1-88646-img0008.jpg)
Immunohistochemistry-Paraffin: PHF6 Antibody [NBP1-88646] - Staining of human ovary shows strong nuclear positivity in follicle and ovarian stroma cells.
![Western Blot: PHF6 Antibody [NBP1-88646] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-433](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16853_PHF6-Antibody-Western-Blot-NBP1-88646-img0005.jpg)
Western Blot: PHF6 Antibody [NBP1-88646] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-433
![Immunocytochemistry/Immunofluorescence: PHF6 Antibody [NBP1-88646] - Staining of human cell line U-251MG shows positivity in nucleus and nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16854_PHF6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88646-img0004.jpg)
Immunocytochemistry/Immunofluorescence: PHF6 Antibody [NBP1-88646] - Staining of human cell line U-251MG shows positivity in nucleus and nucleoli.