Xylulokinase/XYLB Antibody
| Name | Xylulokinase/XYLB Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87919 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Mouse |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Xylulokinase/XYLB Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | XYLB |
| Supplier Page | Shop |
Product images
![Western Blot: Xylulokinase/XYLB Antibody [NBP1-87919] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)<br/>Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/23637_Xylulokinase-XYLB%2520Antibody-Western%2520Blot-NBP1-87919-img0006.jpg)
Western Blot: Xylulokinase/XYLB Antibody [NBP1-87919] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
![Immunocytochemistry/Immunofluorescence: Xylulokinase/XYLB Antibody [NBP1-87919] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/23638_Xylulokinase-XYLB-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87919-img0004.jpg)
Immunocytochemistry/Immunofluorescence: Xylulokinase/XYLB Antibody [NBP1-87919] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: Xylulokinase/XYLB Antibody [NBP1-87919] - Staining of human stomach shows strong cytoplasmic and membrane positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/23639_Xylulokinase-XYLB-Antibody-Immunohistochemistry-Paraffin-NBP1-87919-img0002.jpg)
Immunohistochemistry-Paraffin: Xylulokinase/XYLB Antibody [NBP1-87919] - Staining of human stomach shows strong cytoplasmic and membrane positivity in glandular cells.
![Western Blot: Xylulokinase/XYLB Antibody [NBP1-87919] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/23640_Xylulokinase-XYLB-Antibody-Western-Blot-NBP1-87919-img0005.jpg)
Western Blot: Xylulokinase/XYLB Antibody [NBP1-87919] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4