PLOD1 Antibody
| Name | PLOD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31885 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: YISNIYLIKGSALRGELQSSDLFHHSKLDPDMAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PLOD1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PLOD1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PLOD1 Antibody [NBP2-31885] - Analysis in human cell line U-251 MG.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5037_PLOD1-Antibody-Western-Blot-NBP2-31885-img0007.jpg)
Western Blot: PLOD1 Antibody [NBP2-31885] - Analysis in human cell line U-251 MG.
![Immunohistochemistry-Paraffin: PLOD1 Antibody [NBP2-31885] - Staining of human placenta shows cytoplasmic positivity in decidual cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5038_PLOD1-Antibody-Immunohistochemistry-Paraffin-NBP2-31885-img0008.jpg)
Immunohistochemistry-Paraffin: PLOD1 Antibody [NBP2-31885] - Staining of human placenta shows cytoplasmic positivity in decidual cells.
![Immunohistochemistry: PLOD1 Antibody [NBP2-31885] - Staining of liver.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5039_PLOD1-Antibody-Immunohistochemistry-NBP2-31885-img0002.jpg)
Immunohistochemistry: PLOD1 Antibody [NBP2-31885] - Staining of liver.
![Immunohistochemistry: PLOD1 Antibody [NBP2-31885] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5040_PLOD1-Antibody-Immunohistochemistry-NBP2-31885-img0004.jpg)
Immunohistochemistry: PLOD1 Antibody [NBP2-31885] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.
![Immunohistochemistry: PLOD1 Antibody [NBP2-31885] - Staining of liver cancer..](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5041_PLOD1-Antibody-Immunohistochemistry-NBP2-31885-img0006.jpg)
Immunohistochemistry: PLOD1 Antibody [NBP2-31885] - Staining of liver cancer..