HMBOX1 Antibody
| Name | HMBOX1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32392 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SPSPSNSYDTSPQPCTTNQNGRENNERLSTSNGKMSPTRYHANSMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAFLANRRISQAVV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HMBOX1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HMBOX1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: HMBOX1 Antibody [NBP2-32392] - cerebellum](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7336_HMBOX1-Antibody-Immunohistochemistry-NBP2-32392-img0005.jpg)
Immunohistochemistry: HMBOX1 Antibody [NBP2-32392] - cerebellum
![Immunohistochemistry: HMBOX1 Antibody [NBP2-32392] - Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7337_HMBOX1-Antibody-Immunohistochemistry-NBP2-32392-img0001.jpg)
Immunohistochemistry: HMBOX1 Antibody [NBP2-32392] - Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.
![Immunohistochemistry: HMBOX1 Antibody [NBP2-32392] - cerebellum](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7338_HMBOX1-Antibody-Immunohistochemistry-NBP2-32392-img0002.jpg)
Immunohistochemistry: HMBOX1 Antibody [NBP2-32392] - cerebellum
![Immunohistochemistry: HMBOX1 Antibody [NBP2-32392] - melanoma](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7339_HMBOX1-Antibody-Immunohistochemistry-NBP2-32392-img0003.jpg)
Immunohistochemistry: HMBOX1 Antibody [NBP2-32392] - melanoma
![Immunohistochemistry: HMBOX1 Antibody [NBP2-32392] - Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7340_HMBOX1-Antibody-Immunohistochemistry-NBP2-32392-img0004.jpg)
Immunohistochemistry: HMBOX1 Antibody [NBP2-32392] - Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.
![Immunohistochemistry: HMBOX1 Antibody [NBP2-32392] - melanoma](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7341_HMBOX1%2520Antibody-Immunohistochemistry-NBP2-32392-img0006.jpg)
Immunohistochemistry: HMBOX1 Antibody [NBP2-32392] - melanoma