ANO5 Antibody
| Name | ANO5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32401 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: NTSSTEICDPEIGGQMIMCPLCDQVCDYWRLNSTCLASKFSHLFDNE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ANO5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ANO5 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ANO5 Antibody [NBP2-32401] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7108_ANO5-Antibody-Immunohistochemistry-NBP2-32401-img0005.jpg)
Immunohistochemistry: ANO5 Antibody [NBP2-32401] - liver
![Immunohistochemistry: ANO5 Antibody [NBP2-32401] - Immunohistochemical staining of human cerebral cortex shows distinct cytoplasmic positivity in neuropil.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7109_ANO5-Antibody-Immunohistochemistry-NBP2-32401-img0001.jpg)
Immunohistochemistry: ANO5 Antibody [NBP2-32401] - Immunohistochemical staining of human cerebral cortex shows distinct cytoplasmic positivity in neuropil.
![Immunohistochemistry: ANO5 Antibody [NBP2-32401] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7110_ANO5-Antibody-Immunohistochemistry-NBP2-32401-img0002.jpg)
Immunohistochemistry: ANO5 Antibody [NBP2-32401] - liver
![Immunohistochemistry: ANO5 Antibody [NBP2-32401] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7111_ANO5-Antibody-Immunohistochemistry-NBP2-32401-img0003.jpg)
Immunohistochemistry: ANO5 Antibody [NBP2-32401] - liver cancer
![Immunohistochemistry: ANO5 Antibody [NBP2-32401] - Immunohistochemical staining of human cerebral cortex shows distinct cytoplasmic positivity in neuropil.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7112_ANO5-Antibody-Immunohistochemistry-NBP2-32401-img0004.jpg)
Immunohistochemistry: ANO5 Antibody [NBP2-32401] - Immunohistochemical staining of human cerebral cortex shows distinct cytoplasmic positivity in neuropil.
![Immunohistochemistry: ANO5 Antibody [NBP2-32401] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7113_ANO5%2520Antibody-Immunohistochemistry-NBP2-32401-img0006.jpg)
Immunohistochemistry: ANO5 Antibody [NBP2-32401] - liver cancer