Njmu-R1 Antibody

Name	Njmu-R1 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-82563
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB ICC/IF IHC IHC-P
Species Reactivities	Human
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:PSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSGDDFSLSLADTNLPSEVEPELRSFIAKRLSRGAVFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPETVTI
Purity/Format	Immunogen affinity purified
Blocking Peptide	Njmu-R1 Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	C17orf75
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: Njmu-R1 Antibody [NBP1-82563] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue

Immunocytochemistry/Immunofluorescence: Njmu-R1 Antibody [NBP1-82563] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus.

Immunohistochemistry-Paraffin: Njmu-R1 Antibody [NBP1-82563] - Staining of human cerebral cortex shows dot-like positivity.

Western Blot: Njmu-R1 Antibody [NBP1-82563] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4

Immunocytochemistry/Immunofluorescence: Njmu-R1 Antibody [NBP1-82563] - Staining of mouse olfactory bulb shows positivity in dendrites and cell bodies of mitral cells.

Immunocytochemistry/Immunofluorescence: Njmu-R1 Antibody [NBP1-82563] - Staining of mouse piriform cortex shows staining in neuronal cell bodies and dendrites.

Immunocytochemistry/Immunofluorescence: Njmu-R1 Antibody [NBP1-82563] - Staining of mouse somatosensory cortex shows immunoreactivity in cell bodies and dendrites of pyramidal neurons.

Immunocytochemistry/Immunofluorescence: Njmu-R1 Antibody [NBP1-82563] - Staining of mouse dentate gyrus shows staining in a subset of neurons in granular layer.

Immunocytochemistry/Immunofluorescence: Njmu-R1 Antibody [NBP1-82563] - Staining of mouse medulla shows neuronal staining in the inferior olivary nucleus.

Immunohistochemistry-Paraffin: Njmu-R1 Antibody [NBP1-82563] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Njmu-R1 Antibody [NBP1-82563] - Staining of human cerebral cortex shows dot like positivity in selected areas.