BRP44 Antibody

Name	BRP44 Antibody
Supplier	Novus Biologicals
Catalog	NBP2-31623
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	IHC IHC-P
Species Reactivities	Human, Rat
Antigen	This antibody was developed against a recombinant protein corresponding to amino acids: EKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTAQSAV
Purity/Format	Immunogen affinity purified
Blocking Peptide	BRP44 Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	MPC2
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Immunohistochemistry-Paraffin: BRP44 Antibody [NBP2-31623] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: BRP44 Antibody [NBP2-31623] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: BRP44 Antibody [NBP2-31623] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: BRP44 Antibody [NBP2-31623] - Staining of human pancreas shows moderate cytoplasmic positivity.