TAF11 Antibody (3H5)
| Name | TAF11 Antibody (3H5) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00006882-M03 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone | 3H5 |
| Applications | WB ELISA ICC/IF IHC-P |
| Species Reactivities | Human |
| Antigen | TAF11 (NP_005634 158 a.a. - 210 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | TAF11 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TAF11 Antibody (3H5) [H00006882-M03] - Analysis of TAF11 expression in Hela S3 NE (Cat # L013V3).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/2013_TAF11%2520Antibody%2520(3H5)-Western%2520Blot-H00006882-M03-img0009.jpg)
Western Blot: TAF11 Antibody (3H5) [H00006882-M03] - Analysis of TAF11 expression in Hela S3 NE (Cat # L013V3).
![Immunocytochemistry/Immunofluorescence: TAF11 Antibody (3H5) [H00006882-M03] - Analysis of monoclonal antibody to TAF11 on HeLa cell. Antibody concentration 10 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/2014_TAF11-Antibody-(3H5)-Immunocytochemistry-Immunofluorescence-H00006882-M03-img0005.jpg)
Immunocytochemistry/Immunofluorescence: TAF11 Antibody (3H5) [H00006882-M03] - Analysis of monoclonal antibody to TAF11 on HeLa cell. Antibody concentration 10 ug/ml
![Immunohistochemistry-Paraffin: TAF11 Antibody (3H5) [H00006882-M03] - Analysis of monoclonal antibody to TAF11 on formalin-fixed paraffin-embedded human smooth muscle. Antibody concentration 1.2 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/2015_TAF11-Antibody-(3H5)-Immunohistochemistry-Paraffin-H00006882-M03-img0007.jpg)
Immunohistochemistry-Paraffin: TAF11 Antibody (3H5) [H00006882-M03] - Analysis of monoclonal antibody to TAF11 on formalin-fixed paraffin-embedded human smooth muscle. Antibody concentration 1.2 ug/ml
![Sandwich ELISA: TAF11 Antibody (3H5) [H00006882-M03] - Detection limit for recombinant GST tagged TAF11 is approximately 0.1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/2016_TAF11-Antibody-(3H5)-Sandwich-ELISA-H00006882-M03-img0008.jpg)
Sandwich ELISA: TAF11 Antibody (3H5) [H00006882-M03] - Detection limit for recombinant GST tagged TAF11 is approximately 0.1ng/ml as a capture antibody.