TAF11 Antibody (3G6)

Name	TAF11 Antibody (3G6)
Supplier	Novus Biologicals
Catalog	H00006882-M06
Prices	$359.00
Sizes	100 µg
Host	Mouse
Clonality	Monoclonal
Isotype	IgG1 Kappa
Clone	3G6
Applications	WB ELISA ICC/IF IHC-P
Species Reactivities	Human
Antigen	TAF11 (NP_005634 158 a.a. - 210 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF
Purity/Format	IgG purified
Description	Mouse Monoclonal
Gene	TAF11
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: TAF11 Antibody (3G6) [H00006882-M06] - Analysis of TAF11 expression in Hela S3 NE (Cat # L013V3).

Immunocytochemistry/Immunofluorescence: TAF11 Antibody (3G6) [H00006882-M06] - Analysis of monoclonal antibody to TAF11 on HeLa cell. Antibody concentration 10 ug/ml

Immunohistochemistry-Paraffin: TAF11 Antibody (3G6) [H00006882-M06] - Analysis of monoclonal antibody to TAF11 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1.2 ug/ml

ELISA: TAF11 Antibody (3G6) [H00006882-M06] - Detection limit for recombinant GST tagged TAF11 is approximately 0.1ng/ml as a capture antibody.