UBE2N/Ubc13 Antibody

Name	UBE2N/Ubc13 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-54894
Prices	$139.00, $299.00
Sizes	20 µl, 100 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB ICC/IF
Species Reactivities	Human
Antigen	Synthetic peptides corresponding to UBE2N (ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)) The peptide sequence was selected from the middle region of UBE2N. Peptide sequence GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE.
Purity/Format	Protein A purified
Description	Rabbit Polyclonal
Gene	UBE2N
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: UBE2N/Ubc13 Antibody [NBP1-54894] - Lanes: 1 : 40 ng HIS-UBE2D1 protein2: 40 ng HIS-UBE2D2 protein3: 40 ng HIS-UBE2D3 protein4: 40 ng HIS-UBE2D4 protein5: 40 ng HIS-UBE2E1 protein6: 40 ng HIS-UBE2E2 protein7: 40 ng HIS-UBE2E3 protein8: 40 ng HIS-UBE2K protein9: 40 ng HIS-UBE2L3 protein10: 40 ng HIS-UBE2N protein11 : 40 ng HIS-UBE2V1 protein12: 40 ng HIS-UBE2V2 protein. Primary Antibody Dilution: 1 : 500 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 50,000 Gene name: UBE2N Submitted by: Dr Chris Boutell. MRC-UoG Centre for Virus Research (CVR), UK.

Immunocytochemistry/Immunofluorescence: UBE2N/Ubc13 Antibody [NBP1-54894] - Mouse brain stem cells, 2 ug/ml.

Western Blot: UBE2N/Ubc13 Antibody [NBP1-54894] - NT-2 cell line, mouse brain, Antibody Titration: 2.5ug/ml

Western Blot: UBE2N/Ubc13 Antibody [NBP1-54894] - Sample Type: 1. Human NT-2 cells (60ug) 2. mouse brain extracts (80ug) Primary Antibody Dilution: 2ug/ml Secondary Antibody: IRDye 800CW goat anti-rabbit Secondary Antibody Dilution: 1: 20,000 Image Submitted by: Yuzhi Chen