SGCE Antibody
| Name | SGCE Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59794 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SGCE(sarcoglycan, epsilon) The peptide sequence was selected from the N terminal of SGCE. Peptide sequence TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SGCE |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SGCE Antibody [NBP1-59794] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml SGCE is supported by BioGPS gene expression data to be expressed in 721_B](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/4882_SGCE-Antibody-Western-Blot-NBP1-59794-img0008.jpg)
Western Blot: SGCE Antibody [NBP1-59794] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml SGCE is supported by BioGPS gene expression data to be expressed in 721_B
![Immunohistochemistry: SGCE Antibody [NBP1-59794] - pFA fixed human skeletal muscle tissue at an antibody concentration of 5.0 ug/ml using anti-SGCE antibody](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/4883_SGCE-Antibody-Immunohistochemistry-NBP1-59794-img0005.jpg)
Immunohistochemistry: SGCE Antibody [NBP1-59794] - pFA fixed human skeletal muscle tissue at an antibody concentration of 5.0 ug/ml using anti-SGCE antibody
![Western Blot: SGCE Antibody [NBP1-59794] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/4884_SGCE-Antibody-Western-Blot-NBP1-59794-img0004.jpg)
Western Blot: SGCE Antibody [NBP1-59794] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
![Western Blot: SGCE Antibody [NBP1-59794] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/4885_SGCE-Antibody-Western-Blot-NBP1-59794-img0006.jpg)
Western Blot: SGCE Antibody [NBP1-59794] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
![Western Blot: SGCE Antibody [NBP1-59794] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/4886_SGCE-Antibody-Western-Blot-NBP1-59794-img0007.jpg)
Western Blot: SGCE Antibody [NBP1-59794] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
![Immunohistochemistry-Paraffin: SGCE Antibody [NBP1-59794] - Mouse cerebellum tissue, 1:500 dilution.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/4887_SGCE-Antibody-Immunohistochemistry-Paraffin-NBP1-59794-img0003.jpg)
Immunohistochemistry-Paraffin: SGCE Antibody [NBP1-59794] - Mouse cerebellum tissue, 1:500 dilution.