FAAP Antibody

Name	FAAP Antibody
Supplier	Novus Biologicals
Catalog	NBP1-56855
Prices	$329.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB IHC IHC-P
Species Reactivities	Human
Antigen	Synthetic peptides corresponding to C22ORF28 The peptide sequence was selected from the N terminal of C22ORF28. Peptide sequence PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG.
Purity/Format	Immunogen affinity purified
Description	Rabbit Polyclonal
Gene	RTCB
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: FAAP Antibody [NBP1-56855] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate

Immunohistochemistry: FAAP Antibody [NBP1-56855] - Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Western Blot: FAAP Antibody [NBP1-56855] - Hela, Antibody Dilution: 1.0 ug/ml RTCB is supported by BioGPS gene expression data to be expressed in HeLa.

Western Blot: FAAP Antibody [NBP1-56855] - Jurkat, Antibody Dilution: 1.0 ug/ml RTCB is supported by BioGPS gene expression data to be expressed in Jurkat.

Western Blot: FAAP Antibody [NBP1-56855] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

Western Blot: FAAP Antibody [NBP1-56855] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml