FBPase 1 Antibody
| Name | FBPase 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84721 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FBPase 1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FBP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FBPase 1 Antibody [NBP1-84721] - Analysis in human liver tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17242_FBPase-1-Antibody-Western-Blot-NBP1-84721-img0015.jpg)
Western Blot: FBPase 1 Antibody [NBP1-84721] - Analysis in human liver tissue.
![Immunohistochemistry-Paraffin: FBPase 1 Antibody [NBP1-84721] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17243_FBPase-1-Antibody-Immunohistochemistry-Paraffin-NBP1-84721-img0010.jpg)
Immunohistochemistry-Paraffin: FBPase 1 Antibody [NBP1-84721] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
![Western Blot: FBPase 1 Antibody [NBP1-84721] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17244_FBPase%25201%2520Antibody-Western%2520Blot-NBP1-84721-img0016.jpg)
Western Blot: FBPase 1 Antibody [NBP1-84721] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
![Simple Western: FBPase 1 Antibody [NBP1-84721] - Simple Western lane view shows a specific band for FBP1 in 0.2 mg/ml of RT-4 (left) and NIH-3T3 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17245_FBPase-1-Antibody-Simple-Western-NBP1-84721-img0013.jpg)
Simple Western: FBPase 1 Antibody [NBP1-84721] - Simple Western lane view shows a specific band for FBP1 in 0.2 mg/ml of RT-4 (left) and NIH-3T3 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: FBPase 1 Antibody [NBP1-84721] - Electropherogram image(s) of corresponding Simple Western lane view. FBPase 1 antibody was used at 1:20 dilution on RT-4 and NIH-3T3 lysates(s).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17246_FBPase-1-Antibody-Simple-Western-NBP1-84721-img0014.jpg)
Simple Western: FBPase 1 Antibody [NBP1-84721] - Electropherogram image(s) of corresponding Simple Western lane view. FBPase 1 antibody was used at 1:20 dilution on RT-4 and NIH-3T3 lysates(s).